PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr000261.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 240aa    MW: 27392.8 Da    PI: 8.2094
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr000261.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.67e-141663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++lv +++++G  +W+  ++  g+ R++k+c++rw +yl
      Pbr000261.1 16 KGPWSPEEDQKLVVYIQRYGIWNWSQMPEPAGLARSGKSCRLRWVNYL 63
                     79******************99************************97 PP

2Myb_DNA-binding53.74.9e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E+e ++++++  G++ W++Ia++++ gRt++++k++w +++
      Pbr000261.1  69 RGNFSKDEEETILELHQAIGNR-WSAIAARLP-GRTDNEIKNHWKTHM 114
                      89********************.*********.***********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.9791163IPR017930Myb domain
SuperFamilySSF466892.59E-3014110IPR009057Homeodomain-like
SMARTSM007173.2E-91565IPR001005SANT/Myb domain
PfamPF002491.5E-121663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-231770IPR009057Homeodomain-like
CDDcd001671.84E-71863No hitNo description
PROSITE profilePS5129424.22664118IPR017930Myb domain
SMARTSM007174.9E-1668116IPR001005SANT/Myb domain
PfamPF002491.3E-1569113IPR001005SANT/Myb domain
CDDcd001674.14E-1071114No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2671117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MAKRTQRCEK TVAMKKGPWS PEEDQKLVVY IQRYGIWNWS QMPEPAGLAR SGKSCRLRWV  60
NYLRPDIKRG NFSKDEEETI LELHQAIGNR WSAIAARLPG RTDNEIKNHW KTHMKKRFKA  120
AIESLHEEAK GFGDKEASKN KLSETEQLFL VDEDTRASSS KMETTSSTSA PSRLFCPVWE  180
FDDRKGQIAE QSICASGVTF GDLQSLDSQV WQQEPIFPCD SYINHATSDY WVSLINKTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141185108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744690.0DQ074469.1 Malus x domestica MYB21 mRNA, complete cds.
GenBankKC6912480.0KC691248.1 Malus x domestica MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009373022.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH46e-58MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLQ2LME31e-153Q2LME3_MALDO; MYB transcription factor
STRINGPOPTR_0013s14560.18e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.14e-55myb domain protein 74